2026 AFL season

130th season of the Australian Football League (AFL) From Wikipedia, the free encyclopedia

The 2026 AFL season is the 130th season of the Australian Football League (AFL), the highest-level senior men's Australian rules football competition in Australia. The season features 18 clubs and will run from 5 March to 26 September, comprising a 23-match home-and-away season over 25 rounds, with a five-week finals series featuring the top ten clubs to occur for the first time.

Date5 March – 26 September 2026
Teams18
Matches played108
Total attendance4,187,074 (38,769 per match)
Quick facts Date, Teams ...
2026 AFL premiership season
Date5 March – 26 September 2026
Teams18
Attendance
Matches played108
Total attendance4,187,074 (38,769 per match)
Highest92,231 (round 7, Essendon v Collingwood)
Updated to Hawthorn v Western Bulldogs (round 13).
← 2025
Close

Background

In October 2025, the AFL announced two major changes to be brought into the competition for the 2026 season: the substitute rule was removed in favour of a five-player interchange; and the ball would no longer be bounced in the centre of the ground by a field umpire at the start of quarters and after goals, and would be thrown up instead.[1] The removal of the centre bounce ended a tradition dating back to 1887, with AFL executive general manager of football performance Greg Swann explaining that the skill of bouncing the ball was hindering the development of umpires and that the change would allow umpires to focus more on decision-making and reduce the likelihood of players making accidental umpire contact.[1] The AFL announced seven rule changes to reduce game length by approximately three minutes:[2]

  • The 6–6–6 rule would no longer require at least one player from each team to be in the goalsquare for centre ball-ups.
  • A 'last disposal' free kick would be awarded if the ball crossed the boundary line from a disposal between the 50-metre arcs, unless a nearby player does not attempt to play the ball or blocks an opponent.[a]
  • Ruckmen would no longer be allowed to cross the centre line during centre ball-ups, intended to increase the frequency of jumping ruck contests.
  • Players taking kick-ins would only be given eight seconds to restart play, down from approximately twelve seconds.
  • Field umpires could immediately restart play at around-the-ground ball-ups if a nominated ruckman was too far away or no nomination was made, however the 'third man up' was still not allowed.[b]
  • Players who shrug a tackle would be deemed to have had prior opportunity when considering holding the ball free kicks.
  • Players inside the five-metre protected area after a mark or free kick to an opponent would be required to stand the mark and would no longer be allowed to move out of the area.

Last disposal out of bounds decisions fell within the purview of decisions reviewable by the AFL Review Centre (ARC),[3] as had all out of bounds decisions since the 2025 finals series.[4] There was a key error late in the Geelong v Adelaide match in round 3: the boundary umpire incorrectly paid a last disposal free kick to Geelong instead of Adelaide, and Geelong restarted play before ARC had a chance to intervene, ultimately resulting in a goal to Geelong who won by eight points.[5] The AFL admitted the error the following day and announced a review of its ARC review processes.[3]

The AFL introduced a wildcard finals round, adding an extra week to the existing finals series and increasing the number of finalists from eight to ten; at the end of the home-and-away season, the seventh-placed team would host the tenth-placed team and eighth would host ninth in wildcard finals, before the remainder of the finals series would continue as per the previous final eight system.[6] The change was the first change to the AFL finals system since 2000.[7] The change was negatively received by the AFL Fans Association;[6] however, sports rights analyst Colin Smith explained that the league was protecting the value of the current $4.5 billion broadcast right deal by implementing the new system, with more finalists meaning fewer dead rubber matches later in the home-and-away season.[8]

A State of Origin match took place for the first time since 1999, with Western Australia playing Victoria at Optus Stadium in February 2026;[9] Victoria won the match by 24 points.[10]

Rules governing voting for the Brownlow Medal were changed, to provide umpires a set of player statistics prior to the lodging of votes.[11]

Coach appointments

More information New coach, Club ...
New coachClubDate of appointmentPrevious coachRef.
Josh Carr Port Adelaide12 February 2025[c]Ken Hinkley[12]
Steven King Melbourne12 September 2025Simon Goodwin[13]
Close

Club leadership

More information Club, Coach ...
Club Coach Leadership group
Captain(s)Vice-captain(s)Other leader(s)Ref.
Adelaide Matthew Nicks[14]Jordan DawsonBen Keays, Alex Neal-BullenIsaac Cumming, Darcy Fogarty, Reilly O'Brien, Riley Thilthorpe[15]
Brisbane Lions Chris Fagan[14]Harris Andrews, Josh Dunkley,
Hugh McCluggage		Oscar Allen, Will Ashcroft, Jarrod Berry, Jaspa Fletcher, Cam Rayner[16]
Carlton Michael Voss[17]Patrick CrippsSam Walsh, Jacob Weitering[18]
Collingwood Craig McRae[14]Darcy MooreNick Daicos, Brayden MaynardDarcy Cameron, Jamie Elliott, Isaac Quaynor, Lachie Schultz[19]
Essendon Brad Scott[20]Andrew McGrathJye Caldwell, Sam Durham, Brayden Fiorini, Kyle Langford, Nic Martin, Mason Redman[21]
Fremantle Justin Longmuir[22]Alex PearceAndrew Brayshaw, Caleb SerongJordan Clark, Jaeger O'Meara, Sam Switkowski, Josh Treacy, Hayden Young[23]
Geelong Chris Scott[14]Patrick DangerfieldTom Stewart[24]
Gold Coast Damien Hardwick[14]Noah AndersonSam Collins, Touk MillerBen King, Wil Powell, Matt Rowell[25]
Greater Western Sydney Adam Kingsley[14]Toby GreeneJack Buckley, Tom Green, Connor Idun[26]
Hawthorn Sam Mitchell[27]Jai Newcombe, James Sicily[28]
Melbourne Steven King[29]Max GawnJack Viney[30]
North Melbourne Alastair Clarkson[31]Nick LarkeyHarry SheezelCharlie Comben, Luke Davies-Uniacke, Tristan Xerri, Cameron Zurhaar[32]
Port Adelaide Josh Carr[33]Connor RozeeZak Butters, Willem DrewAliir Aliir, Miles Bergman, Mitch Georgiades, Jack Lukosius[34]
Richmond Adem YzeToby NankervisTim TarantoNathan Broad, Tom Lynch, Jack Ross, Jayden Short[35]
St Kilda Ross Lyon[14]Jack Sinclair, Callum WilkieMitch Owens, Nasiah Wanganeen-Milera, Marcus Windhager, Mason Wood[36]
Sydney Dean Cox[14]Callum MillsIsaac Heeney[37]
West Coast Andrew McQualter[14]Liam Baker, Liam DugganMatt Flynn, Reuben Ginbey, Jack Graham, Brandon Starcevich, Jake Waterman[38]
Western Bulldogs Luke Beveridge[14]Marcus BontempelliAaron Naughton, Ed RichardsBailey Dale, Matthew Kennedy, Tom Liberatore, Cody Weightman, Rhylee West[39]
Close

Pre-season

State of Origin

Main article: 2026 AFL Origin

Starting time is local time. Source: afl.com.au

2026 AFL Origin
Saturday, 14 February (4:40 pm) Western Australia 15.11 (101) def. by Victoria 18.17 (125) Optus Stadium (crowd: 58,141)
3.1 (19)
8.4 (52)
11.6 (72)
15.11 (101)
 Q1
Q2
Q3
Q4
 6.3 (39)
11.8 (74)
15.11 (101)
18.17 (125)
 Graham Moss Medal: Jesse Hogan (Greater Western Sydney)
E. J. Whitten Medal: Lachie Ash (Greater Western Sydney)
Hogan 5, C. Cameron 3, Jackson 2, Waterman 2, Bolton, Hill, Warner Goals King 4, Dangerfield 2, Greene 2, McCluggage 2, Merrett 2, Bontempelli, Butters, Daicos, Serong, Smith, Xerri
Hogan, Warner, Barrass, Hill, Baker, Bolton Best Daicos, Bontempelli, Serong, King, Butters, Ash, Stewart

Practice matches

All starting times are local time. Source: afl.com.au

More information Official practice matches ...
Official practice matches
Wednesday, 25 February (7:10 pm) Carlton 13.8 (86) def. Geelong 11.5 (71) Ikon Park
Thursday, 26 February (4:10 pm) Sydney 14.13 (97) def. Greater Western Sydney 8.11 (59) Henson Park
Thursday, 26 February (6:10 pm) Brisbane Lions 19.12 (126) def. Gold Coast 15.11 (101) Brighton Homes Arena
Friday, 27 February (4:10 pm) Melbourne 12.6 (78) def. Richmond 6.7 (43) Mars Stadium
Friday, 27 February (7:10 pm) Western Bulldogs 18.9 (117) def. Hawthorn 11.7 (73) Mission Whitten Oval
Saturday, 28 February (3:10 pm) St Kilda 17.13 (115) def. Essendon 10.12 (72) Mars Stadium
Saturday, 28 February (3:10 pm) Fremantle 12.12 (84) def. Adelaide 9.14 (68) Lane Group Stadium
Sunday, 1 March (3:10 pm) North Melbourne 12.18 (90) def. Collingwood 14.5 (89) Mars Stadium
Sunday, 1 March (3:10 pm) West Coast 9.13 (67) def. by Port Adelaide 22.8 (140) Mineral Resources Park
  • The Melbourne v Richmond match was abandoned with 14 minutes remaining in the third quarter after play was halted twice due to nearby lightning strikes.[40]
Close

Home-and-away season

All starting times are local time. Source: afl.com.au

Opening Round

More information Opening Round ...
Opening Round
Thursday, 5 March (7:30 pm) Sydney 20.12 (132) def. Carlton 10.9 (69) Sydney Cricket Ground (crowd: 40,372)
Friday, 6 March (7:05 pm) Gold Coast 19.11 (125) def. Geelong 10.9 (69) People First Stadium (crowd: 19,859)
Saturday, 7 March (4:15 pm) Greater Western Sydney 19.8 (122) def. Hawthorn 14.11 (95) Engie Stadium (crowd: 16,157)
Saturday, 7 March (6:35 pm) Brisbane Lions 15.16 (106) def. by Western Bulldogs 16.15 (111) The Gabba (crowd: 31,606)
Sunday, 8 March (7:20 pm) St Kilda 9.12 (66) def. by Collingwood 11.12 (78) Melbourne Cricket Ground (crowd: 82,528)
Bye
  • The crowd of 82,528 for the St Kilda v Collingwood match was the largest crowd for a home-and-away match involving St Kilda.[41]
Close

Round 1

More information Round 1 ...
Round 1
Thursday, 12 March (7:30 pm) Carlton 10.15 (75) def. Richmond 9.17 (71) Melbourne Cricket Ground (crowd: 74,313)
Friday, 13 March (7:40 pm) Essendon 13.5 (83) def. by Hawthorn 21.19 (145) Melbourne Cricket Ground (crowd: 71,384)
Saturday, 14 March (1:15 pm) Western Bulldogs 21.8 (134) def. Greater Western Sydney 7.11 (53) Marvel Stadium (crowd: 28,318)
Saturday, 14 March (4:15 pm) Geelong 16.14 (110) def. Fremantle 14.16 (100) GMHBA Stadium (crowd: 28,715)
Saturday, 14 March (7:10 pm) Sydney 15.14 (104) def. Brisbane Lions 8.12 (60) Sydney Cricket Ground (crowd: 38,128)
Saturday, 14 March (7:35 pm) Collingwood 11.13 (79) def. by Adelaide 13.15 (93) Melbourne Cricket Ground (crowd: 62,482)
Sunday, 15 March (1:10 pm) North Melbourne 17.11 (113) def. Port Adelaide 9.13 (67) Marvel Stadium (crowd: 23,318)
Sunday, 15 March (3:15 pm) Melbourne 18.12 (120) def. St Kilda 15.17 (107) Melbourne Cricket Ground (crowd: 44,577)
Sunday, 15 March (5:10 pm) Gold Coast 20.11 (131) def. West Coast 10.12 (72) People First Stadium (crowd: 13,309)
  • Fremantle's quarter-time score of 8.4 (52) was its highest in a match outside of Western Australia,[42] the equal-highest conceded by Geelong since 1983 and the highest conceded by Geelong at GMHBA Stadium.[43]
Close

Round 2

More information Round 2 ...
Round 2
Thursday, 19 March (7:30 pm) Hawthorn 14.15 (99) def. Sydney 13.4 (82) Melbourne Cricket Ground (crowd: 47,945)
Friday, 20 March (7:10 pm) Adelaide 13.10 (88) def. by Western Bulldogs 14.10 (94) Adelaide Oval (crowd: 49,185)
Saturday, 21 March (1:15 pm) Richmond 9.6 (60) def. by Gold Coast 19.14 (128) Melbourne Cricket Ground (crowd: 30,468)
Saturday, 21 March (4:15 pm) Greater Western Sydney 10.14 (74) def. by St Kilda 11.12 (78) Engie Stadium (crowd: 9,149)
Saturday, 21 March (4:35 pm) Fremantle 17.16 (118) def. Melbourne 10.10 (70) Optus Stadium (crowd: 44,736)
Sunday, 22 March (2:45 pm) Port Adelaide 20.13 (133) def. Essendon 10.10 (70) Adelaide Oval (crowd: 36,049)
Sunday, 22 March (3:10 pm) West Coast 17.9 (111) def. North Melbourne 15.4 (94) Optus Stadium (crowd: 47,083)
Bye
  • The crowd of 49,185 for the Adelaide v Western Bulldogs match was the largest crowd for a home-and-away match between the two clubs.[44]
  • The start of the Greater Western Sydney v St Kilda match was delayed by 50 minutes due to nearby lightning.[45] During the match, which St Kilda won by four points, the second quarter ended with the final 29 seconds wiped from the timeclock due to a technical issue that occurred during a software update, with timekeepers unaware of the issue at the time.[46]
  • West Coast's win over North Melbourne ended a 14-match losing streak.[47]
Close

Round 3

More information Round 3 ...
Round 3
Thursday, 26 March (7:30 pm) Geelong 9.14 (68) def. Adelaide 9.6 (60) GMHBA Stadium (crowd: 20,403)
Friday, 27 March (7:40 pm) Collingwood 13.9 (87) def. Greater Western Sydney 7.12 (54) Marvel Stadium (crowd: 41,607)
Saturday, 28 March (12:35 pm) St Kilda 11.14 (80) def. by Brisbane Lions 17.11 (113) Marvel Stadium (crowd: 31,854)
Saturday, 28 March (1:15 pm) Fremantle 13.25 (103) def. Richmond 6.7 (43) Optus Stadium (crowd: 35,245)
Saturday, 28 March (7:35 pm) Essendon 9.15 (69) def. by North Melbourne 12.9 (81) Marvel Stadium (crowd: 40,154)
Sunday, 29 March (12:00 pm) Port Adelaide 13.12 (90) def. by West Coast 13.14 (92) Adelaide Oval (crowd: 33,754)
Sunday, 29 March (3:15 pm) Carlton 11.11 (77) def. by Melbourne 15.10 (100) Melbourne Cricket Ground (crowd: 67,763)
Bye
  • North Melbourne's win was its first over Essendon since 2016, ending a twelve-match losing streak.[48]
Close

Round 4

More information Round 4 ...
Round 4
Thursday, 2 April (6:30 pm) Brisbane Lions 17.17 (119) def. Collingwood 10.5 (65) The Gabba (crowd: 34,648)
Friday, 3 April (3:15 pm) North Melbourne 14.12 (96) def. Carlton 13.8 (86) Marvel Stadium (crowd: 45,919)
Friday, 3 April (6:45 pm) Adelaide 11.10 (76) def. by Fremantle 11.12 (78) Adelaide Oval (crowd: 48,627)
Saturday, 4 April (4:15 pm) Richmond 6.12 (48) def. by Port Adelaide 13.12 (90) Melbourne Cricket Ground (crowd: 34,471)
Saturday, 4 April (4:35 pm) West Coast 4.11 (35) def. by Sydney 24.19 (163) Optus Stadium (crowd: 50,723)
Sunday, 5 April (3:15 pm) Melbourne 16.13 (109) def. Gold Coast 14.5 (89) Melbourne Cricket Ground (crowd: 24,287)
Sunday, 5 April (7:20 pm) Western Bulldogs 14.15 (99) def. Essendon 9.11 (65) Marvel Stadium (crowd: 38,786)
Monday, 6 April (3:15 pm) Hawthorn 13.14 (92) def. Geelong 14.7 (91) Melbourne Cricket Ground (crowd: 84,712)
Bye
  • Sydney's 128-point win over West Coast was its biggest win in an away match.[49]
Close

Round 5

More information Round 5 (Gather Round) ...
Round 5 (Gather Round)
Thursday, 9 April (7:10 pm) Adelaide 17.12 (114) def. Carlton 12.14 (86) Adelaide Oval (crowd: 49,184)
Friday, 10 April (7:10 pm) Collingwood 5.9 (39) def. by Fremantle 7.3 (45) Adelaide Oval (crowd: 47,275)
Saturday, 11 April (12:05 pm) North Melbourne 9.12 (66) def. by Brisbane Lions 13.14 (92) Barossa Park (crowd: 10,613)
Saturday, 11 April (12:45 pm) Essendon 17.11 (113) def. Melbourne 10.8 (68) Adelaide Oval (crowd: 38,006)
Saturday, 11 April (3:45 pm) Sydney 14.16 (100) def. Gold Coast 9.14 (68) Norwood Oval (crowd: 9,228)
Saturday, 11 April (7:05 pm) Hawthorn 15.14 (104) def. Western Bulldogs 8.16 (64) Adelaide Oval (crowd: 48,451)
Sunday, 12 April (12:00 pm) Geelong 17.20 (122) def. West Coast 11.10 (76) Norwood Oval (crowd: 9,434)
Sunday, 12 April (2:45 pm) Greater Western Sydney 20.11 (131) def. Richmond 11.9 (75) Barossa Park (crowd: 10,508)
Sunday, 12 April (6:45 pm) Port Adelaide 9.13 (67) def. by St Kilda 12.9 (81) Adelaide Oval (crowd: 47,319)
  • Fremantle's score of 7.3 (45) against Collingwood was the lowest winning score in the club's history,[50] and its total of ten scores was the fewest by any winning team since 1968.[51]
  • Essendon's win over Melbourne ended an equal club-record 17-match losing streak.[52]
Close

Round 6

More information Round 6 ...
Round 6
Thursday, 16 April (7:30 pm) Carlton 12.11 (83) def. by Collingwood 13.10 (88) Melbourne Cricket Ground (crowd: 78,058)
Friday, 17 April (7:20 pm) Geelong 19.17 (131) def. Western Bulldogs 8.8 (56) GMHBA Stadium (crowd: 33,200)
Friday, 17 April (7:50 pm) Sydney 17.5 (107) def. Greater Western Sydney 8.18 (66) Sydney Cricket Ground (crowd: 43,986)
Saturday, 18 April (1:15 pm) Gold Coast 17.17 (119) def. Essendon 17.8 (110) People First Stadium (crowd: 19,039)
Saturday, 18 April (4:15 pm) Hawthorn 13.11 (89) def. Port Adelaide 13.8 (86) Marvel Stadium (crowd: 37,070)
Saturday, 18 April (7:05 pm) Adelaide 15.13 (103) def. St Kilda 15.12 (102) Adelaide Oval (crowd: 45,854)
Sunday, 19 April (1:10 pm) North Melbourne 20.10 (130) def. Richmond 7.13 (55) Marvel Stadium (crowd: 36,584)
Sunday, 19 April (3:15 pm) Melbourne 16.8 (104) def. Brisbane Lions 15.12 (102) Melbourne Cricket Ground (crowd: 41,629)
Sunday, 19 April (3:10 pm) West Coast 5.11 (41) def. by Fremantle 14.13 (97) Optus Stadium (crowd: 54,232)
  • Talor Byrne (Carlton) had a shot at goal after the final siren to draw the match against Collingwood, but kicked a behind.[53]
  • Due to nearby lightning, the start of the third quarter of the Sydney v Greater Western Sydney match was delayed by 40 minutes under the AFL's lightning protocols.[54]
  • The crowd of 43,986 for the Sydney v Greater Western Sydney match was the largest crowd for a home-and-away Sydney Derby and the largest between the two clubs at the Sydney Cricket Ground.[55]
Close

Round 7

More information Round 7 (Anzac Appeal Round) ...
Round 7 (Anzac Appeal Round)
Thursday, 23 April (7:30 pm) Western Bulldogs 9.6 (60) def. by Sydney 18.18 (126) Marvel Stadium (crowd: 29,523)
Friday, 24 April (7:40 pm) Richmond 11.6 (72) def. by Melbourne 19.12 (126) Melbourne Cricket Ground (crowd: 67,364)
Saturday, 25 April (12:30 pm) Hawthorn 16.16 (112) def. Gold Coast 9.9 (63) University of Tasmania Stadium (crowd: 8,263)
Saturday, 25 April (3:20 pm) Essendon 9.6 (60) def. by Collingwood 20.17 (137) Melbourne Cricket Ground (crowd: 92,231)
Saturday, 25 April (6:05 pm) Port Adelaide 13.17 (95) def. Geelong 10.5 (65) Adelaide Oval (crowd: 41,164)
Saturday, 25 April (6:15 pm) Fremantle 16.7 (103) def. Carlton 13.11 (89) Optus Stadium (crowd: 54,100)
Sunday, 26 April (1:10 pm) St Kilda 22.11 (143) def. West Coast 5.12 (42) Marvel Stadium (crowd: 29,070)
Sunday, 26 April (3:15 pm) Brisbane Lions 19.13 (127) def. Adelaide 11.9 (75) The Gabba (crowd: 32,629)
Sunday, 26 April (4:40 pm) Greater Western Sydney 15.15 (105) def. North Melbourne 14.14 (98) Corroboree Group Oval (crowd: 12,597)
  • The Hawthorn v Gold Coast match was moved back from 12:15pm to 12:30pm after having mistakenly been scheduled in violation of Tasmanian law prohibiting sporting events from commencing before 12:30pm on Anzac Day; consequently, the Essendon v Collingwood match was moved back by five minutes to minimise overlap between the two matches.[56]
  • The crowd of 54,100 for the Fremantle v Carlton match was the largest crowd for a match between the two clubs.[57]
Close

Round 8

More information Round 8 ...
Round 8
Thursday, 30 April (7:30 pm) Collingwood 15.3 (93) drew with Hawthorn 13.15 (93) Melbourne Cricket Ground (crowd: 76,632)
Friday, 1 May (7:30 pm) Western Bulldogs 15.12 (102) def. by Fremantle 17.12 (114) Marvel Stadium (crowd: 23,071)
Friday, 1 May (7:40 pm) Adelaide 11.10 (76) def. Port Adelaide 11.9 (75) Adelaide Oval (crowd: 53,045)
Saturday, 2 May (12:35 pm) Essendon 11.13 (79) def. by Brisbane Lions 22.11 (143) Marvel Stadium (crowd: 31,595)
Saturday, 2 May (2:15 pm) West Coast 13.10 (88) def. by Richmond 15.9 (99) Optus Stadium (crowd: 46,350)
Saturday, 2 May (4:35 pm) Geelong 21.9 (135) def. North Melbourne 13.8 (86) GMHBA Stadium (crowd: 32,485)
Saturday, 2 May (7:35 pm) Carlton 9.15 (69) def. by St Kilda 16.12 (108) Marvel Stadium (crowd: 41,062)
Sunday, 3 May (3:15 pm) Sydney 19.17 (131) def. Melbourne 17.12 (114) Sydney Cricket Ground (crowd: 40,673)
Sunday, 3 May (7:20 pm) Gold Coast 11.17 (83) def. Greater Western Sydney 8.15 (63) People First Stadium (crowd: 13,537)
  • Dylan Moore (Hawthorn) kicked a goal after the final siren to draw the match against Collingwood.[58]
  • Richmond's win over West Coast ended a twelve-match losing streak.[59]
Close

Round 9

More information Round 9 ...
Round 9
Thursday, 7 May (6:10 pm) Fremantle 12.16 (88) def. Hawthorn 11.7 (73) Optus Stadium (crowd: 54,140)
Friday, 8 May (7:30 pm) Brisbane Lions 14.16 (100) def. Carlton 13.11 (89) The Gabba (crowd: 31,147)
Friday, 8 May (7:40 pm) Port Adelaide 10.12 (72) def. by Western Bulldogs 10.14 (74) Adelaide Oval (crowd: 33,883)
Saturday, 9 May (12:35 pm) North Melbourne 14.13 (97) def. by Sydney 16.9 (105) Marvel Stadium (crowd: 28,156)
Saturday, 9 May (4:15 pm) Greater Western Sydney 16.7 (103) def. Essendon 13.11 (89) Engie Stadium (crowd: 9,416)
Saturday, 9 May (6:40 pm) Gold Coast 13.11 (89) def. St Kilda 8.12 (60) TIO Stadium (crowd: 10,672)
Saturday, 9 May (7:35 pm) Geelong 18.14 (122) def. Collingwood 9.14 (68) Melbourne Cricket Ground (crowd: 83,166)
Sunday, 10 May (1:10 pm) Melbourne 15.9 (99) def. West Coast 9.13 (67) Marvel Stadium (crowd: 16,650)
Sunday, 10 May (3:15 pm) Richmond 9.7 (61) def. by Adelaide 14.14 (98) Melbourne Cricket Ground (crowd: 22,123)
  • The crowd of 54,140 for the Fremantle v Hawthorn match was the largest crowd for a home-and-away match between the two clubs.[60]
Close

Round 10

More information Round 10 (Sir Doug Nicholls Round week 1) ...
Round 10 (Sir Doug Nicholls Round week 1)
Thursday, 14 May (7:30 pm) Brisbane Lions 11.10 (76) def. by Geelong 17.15 (117) The Gabba (crowd: 29,221)
Friday, 15 May (7:30 pm) Sydney 11.15 (81) def. Collingwood 10.15 (75) Sydney Cricket Ground (crowd: 40,627)
Friday, 15 May (7:40 pm) Gold Coast 15.8 (98) def. Port Adelaide 10.13 (73) TIO Stadium (crowd: 11,974)
Saturday, 16 May (12:45 pm) Adelaide 20.13 (133) def. North Melbourne 9.11 (65) Adelaide Oval (crowd: 41,313)
Saturday, 16 May (4:15 pm) Melbourne 18.12 (120) def. Hawthorn 12.9 (81) Melbourne Cricket Ground (crowd: 68,557)
Saturday, 16 May (7:35 pm) Carlton 10.14 (74) def. Western Bulldogs 9.8 (62) Marvel Stadium (crowd: 39,217)
Sunday, 17 May (1:10 pm) Essendon 8.13 (61) def. by Fremantle 16.8 (104) Melbourne Cricket Ground (crowd: 25,100)
Sunday, 17 May (3:15 pm) St Kilda 16.13 (109) def. Richmond 11.7 (73) Marvel Stadium (crowd: 31,230)
Sunday, 17 May (4:15 pm) West Coast 13.10 (88) def. Greater Western Sydney 10.11 (71) Optus Stadium (crowd: 36,781)
  • The crowd of 68,557 for the Melbourne v Hawthorn match was the largest crowd for a home-and-away match between the two clubs.[61]
  • The crowd of 25,100 for the Essendon v Fremantle match was the lowest for a match involving Essendon at the Melbourne Cricket Ground since 1993, excluding matches with restricted crowds during the COVID-19-affected 2020 and 2021 seasons.[62]
Close

Round 11

More information Round 11 (Sir Doug Nicholls Round week 2) ...
Round 11 (Sir Doug Nicholls Round week 2)
Thursday, 21 May (7:30 pm) Hawthorn 10.15 (75) def. Adelaide 9.12 (66) University of Tasmania Stadium (crowd: 8,312)
Friday, 22 May (7:45 pm) Richmond 10.14 (74) def. Essendon 7.14 (56) Melbourne Cricket Ground (crowd: 78,815)
Friday, 22 May (6:30 pm) Fremantle 16.8 (104) def. St Kilda 11.8 (74) Optus Stadium (crowd: 53,707)
Saturday, 23 May (1:15 pm) North Melbourne 17.9 (111) def. Gold Coast 16.9 (105) Marvel Stadium (crowd: 16,260)
Saturday, 23 May (4:15 pm) Geelong 15.17 (107) def. Sydney 12.8 (80) GMHBA Stadium (crowd: 35,869)
Saturday, 23 May (4:35 pm) Collingwood 13.14 (92) def. West Coast 12.10 (82) Melbourne Cricket Ground (crowd: 90,028)
Saturday, 23 May (7:05 pm) Port Adelaide 8.10 (58) def. by Carlton 13.14 (92) Adelaide Oval (crowd: 40,597)
Sunday, 24 May (12:30 pm) Greater Western Sydney 26.10 (166) def. Brisbane Lions 13.10 (88) Engie Stadium (crowd: 8,394)
Sunday, 24 May (3:15 pm) Western Bulldogs 14.9 (93) def. Melbourne 13.12 (90) Marvel Stadium (crowd: 29,708)
  • The crowd of 53,707 for the Fremantle v St Kilda match was the largest crowd for a match between the two clubs.[63]
  • Fremantle's win over St Kilda was its tenth consecutive win, a club record.[63]
  • North Melbourne trailed by 43 points in the second quarter of its match against Gold Coast and went on to win, recording its biggest comeback since 1947;[64] Cameron Zurhaar (North Melbourne) kicked the winning goal after the final siren.[65]
  • Scott Pendlebury (Collingwood) played his 433rd AFL match against West Coast, breaking the VFL/AFL games record held by Brent Harvey (North Melbourne);[66] the crowd of 90,028 for the match was the largest crowd for a home-and-away match involving a non-Victorian club.[67]
  • Greater Western Sydney scored 14.2 (86) in the third quarter of its match against the Brisbane Lions; this was the highest-scoring quarter in the club's history,[68] and the highest-scoring quarter against a reigning premier and highest-scoring third quarter in VFL/AFL history.[69]
  • Greater Western Sydney's final score of 26.10 (166) against the Brisbane Lions was its highest ever.[68]
Close

Round 12

More information Round 12 ...
Round 12
Thursday, 28 May (7:30 pm) St Kilda 9.13 (67) def. by Hawthorn 18.11 (119) Marvel Stadium (crowd: 33,476)
Friday, 29 May (7:40 pm) Carlton 12.16 (88) def. Geelong 12.12 (84) Melbourne Cricket Ground (crowd: 61,081)
Saturday, 30 May (1:15 pm) Sydney 25.20 (170) def. Richmond 8.8 (56) Sydney Cricket Ground (crowd: 38,013)
Saturday, 30 May (4:15 pm) Brisbane Lions 10.18 (78) def. by Fremantle 15.13 (103) The Gabba (crowd: 32,423)
Saturday, 30 May (7:35 pm) Western Bulldogs 14.13 (97) def. Collingwood 13.15 (93) Marvel Stadium (crowd: 43,430)
Sunday, 31 May (2:45 pm) Melbourne 9.16 (70) def. by Greater Western Sydney 19.5 (119) TIO Traeger Park (crowd: 6,374)
Sunday, 31 May (5:20 pm) West Coast 12.13 (85) def. Essendon 8.7 (55) Optus Stadium (crowd: 37,623)
Bye
  • St Kilda scored 0.5 (5) in the first half of its match against Hawthorn; this was its first goalless opening half since 1987 and its equal-lowest half-time score since 1957.[70]
Close

Round 13

More information Round 13 ...
Round 13
Thursday, 4 June (7:00 pm) Adelaide 11.9 (75) def. Geelong 10.14 (74) Adelaide Oval (crowd: 42,340) Report
Friday, 5 June (7:40 pm) Hawthorn 9.17 (71) def. by Western Bulldogs 12.5 (77) Melbourne Cricket Ground (crowd: 59,556) Report
Saturday, 6 June (12:15 pm) North Melbourne 4.7 (31) def. by Fremantle 24.11 (155) Hands Oval (crowd: 13,332) Report
Saturday, 6 June (5:15 pm) Gold Coast 11.9 (75) def. by Brisbane Lions 15.16 (106) People First Stadium (crowd: 21,139) Report
Saturday, 6 June (6:15 pm) West Coast 10.11 (71) def. by Port Adelaide 11.11 (77) Optus Stadium (crowd: 47,479) Report
Sunday, 7 June (3:15 pm) Sydney 15.14 (104) def. St Kilda 15.12 (102) Sydney Cricket Ground (crowd: 42,143) Report
Sunday, 7 June (7:20 pm) Essendon 10.7 (67) def. by Carlton 10.12 (72) Melbourne Cricket Ground (crowd: 76,745) Report
Monday, 8 June (3:15 pm) Collingwood v Melbourne Melbourne Cricket Ground
Bye
  • The crowd of 59,556 for the Hawthorn v Western Bulldogs match was the largest crowd for a home-and-away match between the two clubs.[71]
  • The margin of 124 points in the North Melbourne v Fremantle match was Fremantle's biggest ever win[72] and the biggest loss of North Melbourne coach Alastair Clarkson's coaching career.[73]
  • Fremantle kicked the last 19 goals in its win over North Melbourne, the longest unanswered sequence of goals in its history.[72]
Close

Round 14

More information Round 14 ...
Round 14
Thursday, 11 June (7:30 pm) Western Bulldogs v Adelaide Marvel Stadium
Friday, 12 June (7:40 pm) Geelong v Gold Coast GMHBA Stadium
Saturday, 13 June (1:15 pm) Melbourne v Essendon Melbourne Cricket Ground
Saturday, 13 June (2:15 pm) North Melbourne v West Coast Optus Stadium
Saturday, 13 June (7:05 pm) Port Adelaide v Sydney Adelaide Oval
Sunday, 14 June (1:10 pm) Richmond v Brisbane Lions Ninja Stadium
Sunday, 14 June (3:15 pm) St Kilda v Greater Western Sydney Marvel Stadium
Bye
Close

Round 15

More information Round 15 ...
Round 15
Thursday, 18 June (6:10 pm) Fremantle v Geelong Optus Stadium
Friday, 19 June (7:40 pm) Gold Coast v Hawthorn People First Stadium
Saturday, 20 June (12:45 pm) Adelaide v Melbourne Adelaide Oval
Saturday, 20 June (4:15 pm) Greater Western Sydney v Carlton Engie Stadium
Saturday, 20 June (7:35 pm) Collingwood v Port Adelaide Melbourne Cricket Ground
Sunday, 21 June (1:10 pm) Richmond v North Melbourne Melbourne Cricket Ground
Sunday, 21 June (3:15 pm) St Kilda v Western Bulldogs Marvel Stadium
Bye
Close

Round 16

More information Round 16 ...
Round 16
Thursday, 25 June (7:30 pm) Brisbane Lions v Sydney The Gabba
Friday, 26 June (7:40 pm) Hawthorn v Greater Western Sydney Melbourne Cricket Ground
Saturday, 27 June (1:15 pm) Carlton v West Coast Marvel Stadium
Saturday, 27 June (4:15 pm) Collingwood v Richmond Melbourne Cricket Ground
Saturday, 27 June (7:05 pm) Port Adelaide v Adelaide Adelaide Oval
Sunday, 28 June (3:15 pm) North Melbourne v Essendon Marvel Stadium
Sunday, 28 June (3:10 pm) Fremantle v Gold Coast Optus Stadium
Bye
Close

Round 17

More information Round 17 ...
Round 17
Thursday, 2 July (7:30 pm) Geelong v Brisbane Lions GMHBA Stadium
Friday, 3 July (7:40 pm) Sydney v Western Bulldogs Sydney Cricket Ground
Friday, 3 July (6:10 pm) West Coast v Adelaide Optus Stadium
Saturday, 4 July (1:15 pm) Hawthorn v Melbourne University of Tasmania Stadium
Saturday, 4 July (1:35 pm) Greater Western Sydney v Fremantle Corroboree Group Oval
Saturday, 4 July (4:15 pm) Gold Coast v Collingwood People First Stadium
Saturday, 4 July (7:35 pm) Richmond v Carlton Melbourne Cricket Ground
Sunday, 5 July (3:15 pm) Essendon v St Kilda Marvel Stadium
Sunday, 5 July (4:10 pm) Port Adelaide v North Melbourne Adelaide Oval
Close

Round 18

More information Round 18 ...
Round 18
Thursday, 9 July (6:10 pm) Fremantle v Sydney Optus Stadium
Friday, 10 July (7:40 pm) Collingwood v North Melbourne Marvel Stadium
Saturday, 11 July (1:15 pm) St Kilda v Port Adelaide Marvel Stadium
Saturday, 11 July (4:15 pm) Greater Western Sydney v Geelong Engie Stadium
Saturday, 11 July (7:35 pm) Carlton v Hawthorn Melbourne Cricket Ground
Saturday, 11 July (7:40 pm) Adelaide v Gold Coast Adelaide Oval
Sunday, 12 July (1:10 pm) Western Bulldogs v West Coast Marvel Stadium
Sunday, 12 July (3:15 pm) Melbourne v Richmond Melbourne Cricket Ground
Sunday, 12 July (4:40 pm) Brisbane Lions v Essendon The Gabba
Close

Round 19

More information Round 19 ...
Round 19
Thursday, 16 July (7:30 pm) Geelong v St Kilda GMHBA Stadium
Friday, 17 July (7:40 pm) Sydney v Adelaide Sydney Cricket Ground
Saturday, 18 July (12:45 pm) Port Adelaide v Fremantle Adelaide Oval
Saturday, 18 July (4:15 pm) North Melbourne v Melbourne Marvel Stadium
Saturday, 18 July (7:35 pm) Collingwood v Carlton Melbourne Cricket Ground
Saturday, 18 July (6:10 pm) West Coast v Brisbane Lions Optus Stadium
Sunday, 19 July (1:10 pm) Richmond v Hawthorn Melbourne Cricket Ground
Sunday, 19 July (3:15 pm) Gold Coast v Western Bulldogs People First Stadium
Sunday, 19 July (4:40 pm) Essendon v Greater Western Sydney Marvel Stadium
Close

Round 20

More information Round 20 ...
Round 20
Thursday, 23 July (7:00 pm) Adelaide v Collingwood Adelaide Oval
Friday, 24 July (7:40 pm) Melbourne v Geelong Melbourne Cricket Ground
Friday, 24 July (6:10 pm) Fremantle v West Coast Optus Stadium
Saturday, 25 July (1:05 pm) Carlton v Gold Coast Marvel Stadium
Saturday, 25 July (4:15 pm) Hawthorn v Essendon Melbourne Cricket Ground
Saturday, 25 July (4:35 pm) Greater Western Sydney v Sydney Engie Stadium
Saturday, 25 July (7:40 pm) Western Bulldogs v Richmond Marvel Stadium
Sunday, 26 July (1:10 pm) Brisbane Lions v Port Adelaide The Gabba
Sunday, 26 July (3:15 pm) North Melbourne v St Kilda Marvel Stadium
Close

Round 21

More information Round 21 ...
Round 21
Thursday, 30 July (7:30 pm) Collingwood v Geelong Melbourne Cricket Ground
Friday, 31 July (6:10 pm) Fremantle v Western Bulldogs Optus Stadium
Saturday, 1 August (1:05 pm) St Kilda v Sydney Marvel Stadium
Saturday, 1 August (1:35 pm) Hawthorn v North Melbourne University of Tasmania Stadium
Saturday, 1 August (6:05 pm) Port Adelaide v Greater Western Sydney Adelaide Oval
Saturday, 1 August (7:40 pm) Carlton v Brisbane Lions Marvel Stadium
Sunday, 2 August (1:10 pm) Richmond v West Coast Melbourne Cricket Ground
Sunday, 2 August (3:15 pm) Gold Coast v Melbourne People First Stadium
Sunday, 2 August (4:40 pm) Essendon v Adelaide Marvel Stadium
Close

Round 22

More information Round 22 ...
Round 22
Thursday, 6 August (7:30 pm) Western Bulldogs v North Melbourne Marvel Stadium
Friday, 7 August (7:40 pm) Brisbane Lions v Hawthorn The Gabba
Saturday, 8 August (1:15 pm) Melbourne v Fremantle Melbourne Cricket Ground
Saturday, 8 August (4:15 pm) Sydney v Port Adelaide Sydney Cricket Ground
Saturday, 8 August (4:35 pm) Geelong v Essendon GMHBA Stadium
Saturday, 8 August (7:05 pm) Adelaide v Richmond Adelaide Oval
Sunday, 9 August (1:10 pm) Greater Western Sydney v Gold Coast Corroboree Group Oval
Sunday, 9 August (2:10 pm) West Coast v Collingwood Optus Stadium
Sunday, 9 August (7:20 pm) St Kilda v Carlton Marvel Stadium
Close

Round 23

More information Round 23 ...
Round 23
Dates and times TBC Brisbane Lions v Gold Coast The Gabba
Essendon v Sydney Melbourne Cricket Ground
Fremantle v Adelaide Optus Stadium
Greater Western Sydney v West Coast Engie Stadium
Hawthorn v Collingwood Melbourne Cricket Ground
North Melbourne v Geelong Marvel Stadium
Port Adelaide v Melbourne Adelaide Oval
Richmond v St Kilda Melbourne Cricket Ground
Western Bulldogs v Carlton Marvel Stadium
Close

Round 24

More information Round 24 ...
Round 24
Dates and times TBC Adelaide v Greater Western Sydney Adelaide Oval
Carlton v Fremantle Marvel Stadium
Collingwood v Brisbane Lions Melbourne Cricket Ground
Essendon v Port Adelaide Marvel Stadium
Geelong v Richmond GMHBA Stadium
Melbourne v Western Bulldogs Melbourne Cricket Ground
St Kilda v Gold Coast Marvel Stadium
Sydney v North Melbourne Sydney Cricket Ground
West Coast v Hawthorn Optus Stadium
Close

Ladder

Updated to Essendon v Carlton (round 13).

More information Pos, Team ...
Pos Team Pld W L D PF PA PP Pts Qualification
1 Fremantle 13 12 1 0 1312 887 147.9 48 Finals series
2 Sydney 13 11 2 0 1485 1008 147.3 44
3 Hawthorn 13 8 4 1 1248 1102 113.2 34
4 Geelong 13 8 5 0 1295 1077 120.2 32
5 Western Bulldogs 13 8 5 0 1123 1187 94.6 32
6 Gold Coast 12 7 5 0 1173 1045 112.2 28
7 Adelaide 12 7 5 0 1057 984 107.4 28
8 Brisbane Lions 13 7 6 0 1310 1234 106.2 28
9 Melbourne 12 7 5 0 1190 1169 101.8 28
10 Greater Western Sydney 12 6 6 0 1127 1092 103.2 24
11 Collingwood 12 5 6 1 994 995 99.9 22
12 St Kilda 13 5 8 0 1177 1155 101.9 20
13 Carlton 13 5 8 0 1049 1183 88.7 20
14 North Melbourne 12 5 7 0 1068 1218 87.7 20
15 Port Adelaide 12 4 8 0 983 969 101.4 16
16 West Coast 13 4 9 0 950 1333 71.3 16
17 Richmond 12 2 10 0 787 1304 60.4 8
18 Essendon 13 1 12 0 977 1363 71.7 4
Close
Source: afl.com.au
Rules for classification: 1) points; 2) percentage; 3) number of points for

Progression by round

Updated to Essendon v Carlton (round 13).

4Finished the round in first place0Finished the round in last place
4Finished the round inside the top ten
41Subscript indicates the ladder position at the end of the round
41Underlined points indicate the team had a bye that round
More information Team, O ...
TeamO123456789101112131415161718192021222324
Fremantle0013458312416220224228232236240144148
Sydney4181838412216120124128132136136240244
Hawthorn0846848512616320324326326326630434334
Geelong094941481081112816616920624528332332432
Gold Coast428212112112312516416720524628428528528
Melbourne04741188127129168204207247285286286
Western Bulldogs458312212216116416716101612209201024928732
Adelaide0454841241381112101213161120824824724828
Brisbane Lions060150164138912612916520424424724824928
Greater Western Sydney4341041341541681281412141214161316132012241024
Collingwood4448498781081312111681881810181122102211
St Kilda07014410414414814813121216916112092011201220
North Melbourne04446861251271651661610161216122013201320
Carlton0104114154164154164164164164168161215161420
West Coast00184128981281581581581581512151216161516
Port Adelaide0016474118881081212111213121412141214121616
Richmond00120170180180180180184184184188178178
Essendon00170180170174174174174174174174184184
Close

Source: AFL Tables

Home matches and membership

Updated to Hawthorn v Western Bulldogs (round 13).

The following table includes all home match attendance figures from the home-and-away season, excluding neutral matches (Gather Round).

More information Team, Home match attendance ...
Team Home match attendance Membership
Hosted Total Highest Lowest Average 2025[74] 2026 Change
2025[75] 2026[76] Change
Adelaide6280,36453,04541,313 45,120 46,727Increase 1,607 81,067
Brisbane Lions6191,67434,64829,221 30,598 31,946Increase 1,348 75,115
Carlton6361,49478,05839,217 49,182 60,249Increase 11,067 100,743
Collingwood4270,74990,02841,607 68,873 67,687Decrease 1,186 112,491
Essendon5260,46492,23125,100 40,034 52,093Increase 12,059 85,568
Fremantle5241,92854,14035,245 45,758 48,386Increase 2,628 66,179
Geelong6233,83883,16620,403 35,439 38,973Increase 3,534 92,379
Gold Coast688,39019,85910,672 15,679 14,732Decrease 947 30,107
Greater Western Sydney555,71316,1578,394 12,026 11,143Decrease 883 37,705
Hawthorn6245,85884,7128,263 41,484 40,976Decrease 508 87,204
Melbourne6202,07468,5576,374 36,805 33,679Decrease 3,126 58,563
North Melbourne5150,23745,91916,260 25,266 30,047Increase 4,781 56,283
Port Adelaide5185,44741,16433,754 35,556 37,089Increase 1,533 72,656
Richmond5233,24178,81522,123 44,398 46,648Increase 2,250 92,531
St Kilda5208,15882,52829,070 31,644 41,632Increase 9,988 65,509
Sydney6241,79943,98638,013 34,277 40,300Increase 6,023 76,674
West Coast6272,79254,23236,781 42,576 45,465Increase 2,889 107,079
Western Bulldogs6192,83643,43023,071 36,764 32,139Decrease 4,625 65,584
Total/overall993,917,05692,2316,37437,30639,566Increase 2,2601,363,437
Close

Source: AFL Tables

Win–loss table

Updated to Hawthorn v Western Bulldogs (round 13).

The following table can be sorted from biggest winning margin to biggest losing margin for each round. If multiple matches in a round are decided by the same margin, these margins are sorted by percentage (i.e. the lowest-scoring winning team is ranked highest and the lowest-scoring losing team is ranked lowest). Home matches are in bold, neutral matches (Gather Round) are underlined and opponents are listed above the margins.

+WinQualified for finals
−LossEliminated
Draw
X
 Bye
More information Team, Home-and-away season ...
TeamHome-and-away seasonLadderFinals series
O123456789101112131415161718192021222324F1F2F3F4GF
AdelaideXCOL
+14		WB
–6		GEE
–8		FRE
–2		CAR
+28		STK
+1		BL
–52		PA
+1		RIC
+37		NM
+68		HAW
–9		XGEE
+1		WBMELPAWCGCSYDCOLESSRICFREGWS7
(7–5–0)
Brisbane LionsWB
–5		SYD
–44		XSTK
+33		COL
+54		NM
+26		MEL
–2		ADE
+52		ESS
+64		CAR
+11		GEE
–41		GWS
–78		FRE
–25		GCRICXSYDGEEESSWCPACARHAWGCCOL9
(6–6–0)
CarltonSYD
–63		RIC
+4		XMEL
–23		NM
–10		ADE
–28		COL
–5		FRE
–14		STK
–39		BL
–11		WB
+12		PA
+34		GEE
+4		ESSXGWSWCRICHAWCOLGCBLSTKWBFRE14
(4–8–0)
CollingwoodSTK
+12		ADE
–14		XGWS
+33		BL
–54		FRE
–6		CAR
+5		ESS
+77		HAW
0		GEE
–54		SYD
–6		WC
+10		WB
–4		MELXPARICGCNMCARADEGEEWCHAWBL11
(5–6–1)
EssendonXHAW
–62		PA
–63		NM
–12		WB
–34		MEL
+45		GC
–9		COL
–77		BL
–64		GWS
–14		FRE
–43		RIC
–18		WC
–30		CARMELXNMSTKBLGWSHAWADEGEESYDPA18
(1–11–0)
FremantleXGEE
–10		MEL
+48		RIC
+60		ADE
+2		COL
+6		WC
+56		CAR
+14		WB
+12		HAW
+15		ESS
+43		STK
+30		BL
+25		NMXGEEGCGWSSYDPAWCWBMELADECAR1
(11–1–0)
GeelongGC
–56		FRE
+10		XADE
+8		HAW
–1		WC
+46		WB
+75		PA
–30		NM
+49		COL
+54		BL
+41		SYD
+27		CAR
–4		ADE
–1		GCFREXBLGWSSTKMELCOLESSNMRIC4
(8–5–0)
Gold CoastGEE
+56		WC
+59		RIC
+68		XMEL
–20		SYD
–32		ESS
+9		HAW
–49		GWS
+20		STK
+29		PA
+25		NM
–6		XBLGEEHAWFRECOLADEWBCARMELGWSBLSTK6
(7–4–0)
Greater Western SydneyHAW
+27		WB
–81		STK
–4		COL
–33		XRIC
+56		SYD
–41		NM
+7		GC
–20		ESS
+14		WC
–17		BL
+78		MEL
+49		XSTKCARHAWFREGEEESSSYDPAGCWCADE10
(6–6–0)
HawthornGWS
–27		ESS
+62		SYD
+17		XGEE
+1		WB
+40		PA
+3		GC
+49		COL
0		FRE
–15		MEL
–39		ADE
+9		STK
+52		WB
–6		XGCGWSMELCARRICESSNMBLCOLWC3
(8–4–1)
MelbourneXSTK
+13		FRE
–48		CAR
+23		GC
+20		ESS
–45		BL
+2		RIC
+54		SYD
–17		WC
+32		HAW
+39		WB
–3		GWS
–49		COLESSADEXHAWRICNMGEEGCFREPAWB8
(7–5–0)
North MelbourneXPA
+46		WC
–17		ESS
+12		CAR
+10		BL
–26		RIC
+75		GWS
–7		GEE
–49		SYD
–8		ADE
–68		GC
+6		XFREWCRICESSPACOLMELSTKHAWWBGEESYD13
(5–6–0)
Port AdelaideXNM
–46		ESS
+63		WC
–2		RIC
+42		STK
–14		HAW
–3		GEE
+30		ADE
–1		WB
–2		GC
–25		CAR
–34		XWCSYDCOLADENMSTKFREBLGWSSYDMELESS16
(3–8–0)
RichmondXCAR
–4		GC
–68		FRE
–60		PA
–42		GWS
–56		NM
–75		MEL
–54		WC
+11		ADE
–37		STK
–36		ESS
+18		SYD
–114		XBLNMCOLCARMELHAWWBWCADESTKGEE17
(2–10–0)
St KildaCOL
–12		MEL
–13		GWS
+4		BL
–33		XPA
+14		ADE
–1		WC
+101		CAR
+39		GC
–29		RIC
+36		FRE
–30		HAW
–52		SYDGWSWBXESSPAGEENMSYDCARRICGC12
(5–7–0)
SydneyCAR
+63		BL
+44		HAW
–17		XWC
+128		GC
+32		GWS
+53		WB
+66		MEL
+17		NM
+8		COL
+6		GEE
–27		RIC
+114		STKPAXBLWBFREADEGWSSTKPAESSNM2
(10–2–0)
West CoastXGC
–59		NM
+17		PA
+2		SYD
–128		GEE
–46		FRE
–56		STK
–101		RIC
–11		MEL
–32		GWS
+17		COL
–10		ESS
+30		PANMXCARADEWBBLFRERICCOLGWSHAW15
(4–8–0)
Western BulldogsBL
+5		GWS
+81		ADE
+6		XESS
+34		HAW
–40		GEE
–75		SYD
–66		FRE
–12		PA
+2		CAR
–12		MEL
+3		COL
+4		HAW
+6		ADESTKXSYDWCGCRICFRENMCARMEL5
(8–5–0)
Close

Source: AFL Tables

Milestones

More information Round, Player/official ...
Round Player/official Club Milestone
OR Isaac Heeney Sydney300th AFL goal
Jesse Hogan Greater Western Sydney400th AFL goal
Rory Lobb Western Bulldogs200th AFL game
1 Blake Hardwick Hawthorn200th AFL game
Daniel McStay Collingwood200th AFL game
Darcy Fogarty Adelaide200th AFL goal
Christian Salem Melbourne200th AFL game
3 Jake Stringer Greater Western Sydney400th AFL goal
Max Gawn Melbourne250th AFL game
Tom McDonald Melbourne250th AFL game
4 Tom Papley Sydney200th AFL game
Aaron Naughton Western Bulldogs300th AFL goal
5 Jake Melksham Melbourne250th AFL game
6 Mark Blicavs Geelong300th AFL game
Jake Kolodjashnij Geelong200th AFL game
Karl Amon Hawthorn200th AFL game
Josh Dunkley Brisbane Lions200th AFL game
Lachie Neale Brisbane Lions300th AFL game
Shai Bolton Fremantle200th AFL goal
7 Bayley Fritsch Melbourne300th AFL goal
8 Nick Larkey North Melbourne300th AFL goal
Brodie Grundy Sydney250th AFL game
9 Tom Stewart Geelong200th AFL game
Daniel McStay Collingwood200th AFL goal
10 Zac Bailey Brisbane Lions200th AFL goal
11 Jayden Short Richmond200th AFL game
Dan Houston Collingwood200th AFL game
Close

Source: AFL Tables

Coach departures

More information Outgoing coach, Club ...
Outgoing coachClubManner of departureDate of departureCaretaker coachIncoming coachDate of appointment
Michael Voss CarltonResigned12 May 2026[77]Josh Fraser[78]
Brad Scott EssendonDismissed with year-and-a-half remaining on contract26 May 2026[79]Dean Solomon[80]
Close

Leading goalkickers

Updated to end of round 12.

1Led the goalkicking at the end of the round
11Subscript indicates the player's goal tally to that point of the season
–Did not play during that round
XHad a bye during that round
More information #, Player ...
# Player Club Home-and-away season (Coleman Medal) Finals series Total Games Average
O123456789101112131415161718192021222324F1F2F3F4GF
1 Jack GunstonHawthorn4459413X13316319–19524024630–30–305353593.89
2 Jeremy CameronGeelong–033X3031437101732032312432733043434113.09
Ben KingGold Coast4459716X16319221324226228432133134X3434113.09
4 Charlie CurnowSydney330325X54909312719120121X2122383131112.82
5 Jye AmissFremantleX0110123472951431701732022242643030122.50
Nick WatsonHawthorn224617X731011151621822032332622823030122.50
7 Aaron NaughtonWestern Bulldogs2268311X1131411531811922122332622812929112.42
8 Josh TreacyFremantleX0224641021201211331631922122322532828122.33
9 Charlie CameronBrisbane Lions4426X628081931241621822032322522727122.25
Mitch GeorgiadesPort AdelaideX0332538210212214418321425126127X2727112.45
Close

Source: AFL Tables

See also

Notes

  1. [a]
    Consistent with the rule used in the AFL Women's (AFLW) and South Australian National Football League (SANFL)
  2. [b]
    Consistent with the rule used in the AFLW
  3. [c]
    Announcement of succession plan

References

External links

Related Articles

Wikiwand AI