Bukatoxin
From Wikipedia, the free encyclopedia
Bukatoxin is an α-scorpion toxin found in the venom of the Chinese scorpion Buthus martensi Karsch. By blocking the inactivation of sodium ion channels, α-scorpion toxins prolong action potentials.[1]
Bukatoxin (short names: BukaTx or BKTx, alternative name: BuK-alpha-Tx) is a neurotoxin that is expressed and secreted by the venom gland of the scorpion Buthus martensii Karsch (Chinese Scorpion).[2]
Chemistry
Bukatoxin is a 65-residue peptide with the amino acid sequence VRDGYIADDKNCAYFCGRNAYCDEECIINGAESGYCQQAGVYGNACWCYKLPDKVPIRVSGECQQ, and has four disulfide bridges (Cys12-Cys63, Cys16-Cys36, Cys22-Cys46, Cys26-Cys48).[2] The molecular weight of the neurotoxin is 7.2 kDa.[1][2] Bukatoxin is a member of the 4C-C scorpion toxin superfamily.[2] It can be further categorized as a polypeptide gating modifier toxin that belongs to the α-subfamily of scorpion neurotoxins.[1]