Draft:SHMOOSE
Mitochondria-derived microprotein discovered in 2022
From Wikipedia, the free encyclopedia
SHMOOSE (Small Human Mitochondrial ORF Over SErine tRNA) is a mitochondrial DNA-encoded microprotein identified through genetic and proteomic studies linking mitochondrial variation to Alzheimer’s disease and mitochondrial biology.[1]
 | Review waiting, please be patient.
This may take 2 months or more, since drafts are reviewed in no specific order. There are 3,598 pending submissions waiting for review.
Where to get help
How to improve a draft
You can also browse Wikipedia:Featured articles and Wikipedia:Good articles to find examples of Wikipedia's best writing on topics similar to your proposed article. Improving your odds of a speedy review To improve your odds of a faster review, tag your draft with relevant WikiProject tags using the button below. This will let reviewers know a new draft has been submitted in their area of interest. For instance, if you wrote about a female astronomer, you would want to add the Biography, Astronomy, and Women scientists tags. Editor resources
Reviewer tools
|
Comment: In accordance with the Wikimedia Foundation's Terms of Use, I disclose that I have been paid by my employer for my contributions to this article. BethNewcomb (talk) 20:23, 19 March 2026 (UTC)
Discovery
SHMOOSE was first described by the Pinchas Cohen lab in 2022 in a study searching for mitochondrial genome variants associated with Alzheimer’s disease. Researchers performing a mitochondrial-wide association study (MiWAS) identified the single nucleotide polymorphism rs2853499 within a previously unannotated small open reading frame (sORF) in the mitochondrial genome. This sORF encodes a previously unrecognized microprotein, later named SHMOOSE. Using mass spectrometry, two unique peptide fragments corresponding to SHMOOSE were detected in mitochondrial fractions, representing the first mass spectrometry–based detection of a mitochondrial-encoded microprotein.[2]
Coding sequence and peptide
The SHMOOSE coding sequence is located in the human mitochondrial genome, overlapping the serine tRNA region and the MT-ND5 gene, which encodes a subunit of mitochondrial Complex I. The sORF containing rs2853499 encodes a peptide of 58 amino acids: MPPCLTTWLSQLLKDNSYPLVLGPKNFGATPNKSNNHAHYYNHPNPDFPNSPHPYHPR.[3]
Function
Functional studies indicate that SHMOOSE localizes to mitochondria and can influence mitochondrial activity. In vitro and animal models have shown that SHMOOSE can bind to mitochondrial proteins such as mitofilin, localize to the inner mitochondrial membrane, and affect mitochondrial bioenergetics, including oxygen consumption. In neuronal models, SHMOOSE has been reported to modulate responses to amyloid-β toxicity and cell stress.[4]
Clinical significance
Levels of SHMOOSE-derived peptides measured in human cerebrospinal fluid have been reported to correlate with age, cerebrospinal fluid tau, and measures of brain white matter, linking SHMOOSE to markers of neurodegeneration.[4] A mutation within the SHMOOSE gene partially inactivates the microprotein and is associated with a 30% higher risk for Alzheimer's disease. The mutation is found in nearly 25% of people with European ancestry.[5][6]