Wikiwand AI

Neuromedin B

From Wikipedia, the free encyclopedia

Neuromedin B (NMB) is a bombesin-related peptide in mammals.[1][2] It was originally purified from pig spinal cord, and later shown to be present in human central nervous system and gastrointestinal tract.[3]

The sequence of the C-terminal decapeptide is highly conserved across mammalian species: GNLWATGHFM-(NH2); this decapeptide is sometimes noted as neuromedin B, but it is more accurately described as neuromedin B 23-32. The sequence of neuromedin B (in rat) is: TPFSWDLPEPRSRASKIRVHPRGNLWATGHFM-(NH2).[4] The (NH2) here indicates a post-translational modification -- alpha amidation of the carboxy terminus.

Function

Figure 1: NMB, 7-TMR receptor and G-protein
Figure 2 : Signal Cascade after NMB binding

Neuromedin regulates the following functions:

  • exocrine and endocrine secretions
  • cell growth
  • body temperature
  • blood pressure and glucose level
  • sneezing[5]

Neuromedin signaling pathway

References

Related Articles

Timelines

Top Qs

Fact Checks