Neuromedin B
From Wikipedia, the free encyclopedia
| neuromedin B | |||||||
|---|---|---|---|---|---|---|---|
| Identifiers | |||||||
| Symbol | NMB | ||||||
| NCBI gene | 4828 | ||||||
| HGNC | 7842 | ||||||
| OMIM | 162340 | ||||||
| RefSeq | NM_021077 | ||||||
| UniProt | P08949 | ||||||
| Other data | |||||||
| Locus | Chr. 15 q11-qter | ||||||
| |||||||
Neuromedin B (NMB) is a bombesin-related peptide in mammals.[1][2] It was originally purified from pig spinal cord, and later shown to be present in human central nervous system and gastrointestinal tract.[3]
The sequence of the C-terminal decapeptide is highly conserved across mammalian species: GNLWATGHFM-(NH2); this decapeptide is sometimes noted as neuromedin B, but it is more accurately described as neuromedin B 23-32. The sequence of neuromedin B (in rat) is: TPFSWDLPEPRSRASKIRVHPRGNLWATGHFM-(NH2).[4] The (NH2) here indicates a post-translational modification -- alpha amidation of the carboxy terminus.