Tamapin

From Wikipedia, the free encyclopedia

Tamapin is a toxin from the Indian Red Scorpion (Hottentotta tamulus), which is a selective and potent blocker of SK2 channels.

Tamapin is named after the scorpion from which it was isolated.[1]

Sources

Tamapin has been isolated from hottentotta tamulus, the Indian red scorpion.[2]

Chemical structure and methods of isolation

Tamapin belongs to short-chain scorpion toxin subfamily 5, together with PO5 and Scyllatoxin. Its sequence similarity to other toxins that can compete with the binding site of apamin is much lower. It is 31 amino acids long and its weight is 3458 daltons. Its amino acid sequence is AFCNLRRCELSCRSLGLLGKCIGEECKCVPY, with disulfide bonds between Cys3-Cys21, Cys8-Cys26, and Cys12-Cys28 (chemical formula C146H234N42O42S6). [1]

Tamapin has been isolated via detection of the apamin-competing fraction of the venom from the scorpion via a Sephadex G-50 size exclusion chromatography, followed by high performance liquid chromatography (HPLC).[1] An isoform of tamapin, tamapin-2, has been found, in which the tyrosine is replaced by a histadine. Tamapin-2 can also compete very effectively with apamin for binding to synaptosomes.[1]

Target and mode of action

Toxicity

References

Related Articles

Wikiwand AI