Wikiwand AI

AmmTX3

From Wikipedia, the free encyclopedia

SuperfamilyShort scorpion toxins
Subfamilyα-KTX15
Amino acidZIETNKKCQGGSCASVCRKVIGVAAGKCINGRCVCYP[1]
AmmTX3
SuperfamilyShort scorpion toxins
FamilyScorpion toxins
Subfamilyα-KTX15
Amino acidZIETNKKCQGGSCASVCRKVIGVAAGKCINGRCVCYP[1]
Molecular weight3823.5 Da

AmmTX3, produced by Androctonus mauretanicus, is a scorpion toxin of the α-KTX15 subfamily. The toxin is known for its ability to act as a specific Kv4 channel blocker, and thereby reducing the A-type potassium current through this channel.

AmmTX3 (α-KTX15.3) is a peptide that can be isolated from the venom of Androctonus mauretanicus.[1] Androctonus mauretanicus is a fat-tailed scorpion with its origins in North Africa.

Chemistry

AmmTX3 has a molecular mass of 3823.5 Da and consists of a single chain of 37 amino acid residues. These residues are cross-linked by three disulfide bridges.[1] The toxin contains the dyad characteristic (K27 and Y36) that is found in pore-blocking potassium channel-specific toxins, and is therefore likely to act as a pore blocker.

AmmTX3 is a member of the α-KTX15 subfamily. This subfamily currently exists of six very homologous peptides, originating from scorpion venom: Aa1, AaTX1, AaTX2, AmmTX3, BmTx3 and Discrepin.[1][2] Toxins of the α-KTX15 subfamily all seem to have an effect on the A-type potassium current.

Target

AmmTX3 is a specific pore blocker of Kv4.2 and Kv4.3 channels of mice. This high-affinity blockade depends on the expression of dipeptidyl peptidase-like proteins (DPP) DPP6 and DPP10, which are proteins that co-assemble with the alpha-subunits of Kv4 channels.[2][3] Besides its potent ability to block Kv4 channel, AmmTx3 also has a small blocking effect on hERG channels without alteration of the gating kinetics.[4]

Mode of action

Toxicity

References

Related Articles

Timelines

Top Qs

Fact Checks